Recombinant Protein of Mouse MRPL50, aa 1-159(Cat#: RIJL-0225-JL449)
This product is a recombinant mouse MRPL50 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPL50 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Mouse |
Molecule Mass |
18.2 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
E.coli |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
1-159aa |
Sequence |
MAALIVSRLARRGWLWKLPLATRREFWSRSRKEKEPVVAETVEEVKKEPVLVCPPLRSRAYTPPSDLQSRLESHIKEVLGSSLPNNWQDISLDDGHMKFRLLAGLADGLGHAVPNSRLHQMCRVRDVLDFYNVPVQDKSKFDELVASNLPPNLKISWSY |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Large Ribosomal Subunit Protein ML50; Mitochondrial Large Ribosomal Subunit Protein ML50; Mitochondrial Ribosomal Protein L50; MRP-L50; Mitochondrial 39S Ribosomal Protein L50 |
Gene ID |
28028 |
UniProt ID |
Q8VDT9 |
Location |
Mitochondrion |
Introduction |
MRPL50 is a vital component of the mitochondrial large ribosomal subunit, playing a fundamental role in the translation of mitochondrial mRNAs into functional proteins. Its presence ensures the fidelity and efficiency of mitochondrial protein synthesis. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.