Recombinant Protein of Mouse MRPL17, aa 9-176(Cat#: RIJL-0225-JL406)
This product is a recombinant mouse MRPL17 protein with specific tag. It is availible for SDS-PAGE, WB, bioactivity testing, ELISA and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPL17 protein with specific tag. It is availible for SDS-PAGE, WB, bioactivity testing, ELISA and immunogen. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 13.3 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 9-176aa |
| Sequence | ISHGRVYRRLGLGPESRIHLLRNLLTGLVRHERIEATWARADEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQDRAKMAVIEYKGNYLPPLPLPHRDSNLTLLNQLLLGLQQDLHHNQDASLHSSCTVQTPKT |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; Bioactivity Testing; ELISA; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein BL17m; LYST-Interacting Protein 2; Mitochondrial Ribosomal Protein L17 |
| Gene ID | 27397 |
| UniProt ID | Q9D8P4 |
| Location | Mitochondrion |
| Introduction | MRPL17 is an indispensable element of the large ribosomal subunit in the mitochondrial translational machinery of eukaryotic organisms. It contributes to the structural integrity and functional efficiency of the mitochondrial ribosome, enabling the accurate and efficient synthesis of proteins critical for oxidative phosphorylation and other essential mitochondrial processes. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
