Recombinant Protein of Mouse EXOSC2, aa 1-293(Cat#: RIJL-1124-JL124)
This product is a recombinant mouse EXOSC2 protein with specific tag. It is availible for SDS-PAGE, positive control and immunogen.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse EXOSC2 protein with specific tag. It is availible for SDS-PAGE, positive control and immunogen. |
Product Property
| Species Reactivity |
Mouse |
| Molecule Mass |
32.6 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
Low endotoxin |
| Expression Host |
E Coli or Yeast or Baculovirus or Mammalian Cell |
| Formulation |
PBS with 6% trehalose |
| Residues |
1-293aa |
| Sequence |
MALEMRLPKARKPLSESLGRDSKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYNGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKDEDAGGFIANLEPVALSDREVISRLRNCVVLLVTQRMMLFDTSILYCYEASLAHQIKDILKPEVMEEIMLETRQRLLDQEG |
| Product Form |
Lyophilized or liquid |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
SDS-PAGE; Positive Control; Immunogen |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Rrp4; Ribosomal RNA-processing protein 4 |
| Gene ID |
227715 |
| UniProt ID |
Q8VBV3 |
| Location |
Nucleus; Cytoplasm |
| Introduction |
The three major untranslated regions of mammalian mRNA contain AU-rich elements (AREs). EXOSC2 is an essential component of human exosomes. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.