Loading...
Book a Meeting

Recombinant Protein of Mouse EXOSC2, aa 1-293(Cat#: RIJL-1124-JL124)

This product is a recombinant mouse EXOSC2 protein with specific tag. It is availible for SDS-PAGE, positive control and immunogen.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant mouse EXOSC2 protein with specific tag. It is availible for SDS-PAGE, positive control and immunogen.

Product Property

Species Reactivity Mouse
Molecule Mass 32.6 kDa
Purity >85% determined by SDS-PAGE
Endotoxin Low endotoxin
Expression Host E Coli or Yeast or Baculovirus or Mammalian Cell
Formulation PBS with 6% trehalose
Residues 1-293aa
Sequence MALEMRLPKARKPLSESLGRDSKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYNGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKDEDAGGFIANLEPVALSDREVISRLRNCVVLLVTQRMMLFDTSILYCYEASLAHQIKDILKPEVMEEIMLETRQRLLDQEG
Product Form Lyophilized or liquid
Tags Tag type will be determined during the manufacturing process.
Type Recombinant Protein
Applications SDS-PAGE; Positive Control; Immunogen
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names Rrp4; Ribosomal RNA-processing protein 4
Gene ID 227715
UniProt ID Q8VBV3
Location Nucleus; Cytoplasm
Introduction The three major untranslated regions of mammalian mRNA contain AU-rich elements (AREs). EXOSC2 is an essential component of human exosomes.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry