Recombinant Protein of Human RPS6KB1, aa 91-352(Cat#: RIJL-1124-JL112)
This product is a recombinant human RPS6KB1 protein with N-terminal His tag. It is availible for SDS-PAGE, WB and positive control.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPS6KB1 protein with N-terminal His tag. It is availible for SDS-PAGE, WB and positive control. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 33 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | PBS, pH 7.4, containing 0.01% SKL and 5% trehalose |
| Residues | 91-352aa |
| Sequence | FELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIY AFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQG HVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFF |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; Positive Control |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | PS6K; S6K; S6K1; STK14A; p70(S6K)-alpha; p70-S6K; p70-alpha; P70-S6 Kinase 1; 70 kDa ribosomal protein S6 kinase 1 |
| Gene ID | 6198 |
| UniProt ID | P23443 |
| Location | Nucleus; Cytoplasm |
| Introduction | RPS6KB1 is a serine/threonine kinase that acts downstream of PIP3 and phosphoinositide-dependent kinase-1 in the PI3 kinase pathway. Studies have shown that RPS6KB1 activity plays an active role in increased autophagy. In addition, RPS6KB1 leads to increased protein synthesis and cell proliferation. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
