Recombinant Protein of Human RPS6KA5, aa 2-348(Cat#: RIJL-1124-JL109)
This product is a recombinant human RPS6KA5 protein with N-terminal His tag. It is availible for positive control, immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPS6KA5 protein with N-terminal His tag. It is availible for positive control, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 42.5 kDa |
| Purity | >95% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 20mM Tris-HCl, pH 8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% trehalose and proclin 300 |
| Residues | 2-348aa |
| Sequence | EEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFE LLKVLGTGAYGKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRT ERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFT EHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSK EFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWSLGVLMYELLT GASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNF |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Positive Control; Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MSK1; MSPK1; RLPK; RSKL; RSK-like protein kinase; 90 kDa ribosomal protein S6 kinase 5; Nuclear mitogen- and stress-activated protein kinase 1 |
| Gene ID | 9252 |
| UniProt ID | O75582 |
| Location | Nucleus; Cytoplasm |
| Introduction | RPS6KA5, together with RPS6KA4, is thought to mediate the phosphorylation of histone H3, which is closely related to the expression of immediate early genes. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
