Recombinant Protein of Human RPS6KA1, aa 62-321(Cat#: RIJL-1124-JL104)
This product is a recombinant human RPS6KA1 protein with N-terminal His tag. It is availible for positive control, immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPS6KA1 protein with N-terminal His tag. It is availible for positive control, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 33.5 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 100mM NaHCO₃, pH 8.3, containing 0.01% SKL and 5% trehalose |
| Residues | 62-321aa |
| Sequence | FELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFY |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Positive Control; Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MAPKAPK1A; RSK; RSK1; S6K-alpha 1; 90 kDa ribosomal protein S6 kinase 1; MAP kinase-activated protein kinase 1a |
| Gene ID | 6195 |
| UniProt ID | Q15418 |
| Location | Nucleus; Cytoplasm |
| Introduction | RPS6KA1 contains 2 different kinase catalytic domains that can phosphorylate a variety of substrates, such as members of the MAPK signaling pathway. RPS6KA1 plays an essential role in the regulation of cell growth and differentiation. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
