Recombinant Protein of Human RPLP2, aa 1-115(Cat#: RIJL-1124-JL177)
This product is a recombinant human RPLP2 protein with N-terminal His tag. It is availible for ELISA, Affinity purification and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPLP2 protein with N-terminal His tag. It is availible for ELISA, Affinity purification and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 15.3kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | PBS, pH 7.4, containing 0.01% SKL and 5% trehalose |
| Residues | 1-115aa |
| Sequence | MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | ELISA; Affinity Purification; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Recombinant Ribosomal Protein, Large, P2 (RPLP2) P2; RPP2; 60S Acidic Ribosomal Protein P2; Acidic Ribosomal Phosphoprotein P2 |
| Gene ID | 6181 |
| UniProt ID | P05387 |
| Location | Cytoplasm |
| Introduction | The RPLP2 gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. RPLP2 plays an important role in the elongation step of protein synthesis. RPLP2 is located in the cytoplasm. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
