Recombinant Protein of Human RPL36AL, aa 1-106(Cat#: RIJL-0225-JL301)
This product is a recombinant human RPL36AL protein with N-terminal GST Tag. It is availible for standard, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPL36AL protein with N-terminal GST Tag. It is availible for standard, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 39.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-106aa |
| Sequence | MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF |
| Product Form | Lyophilized powder |
| Tags | N-terminal GST Tag |
| Type | Recombinant Protein |
| Applications | Standard; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein L36a Like; Large Ribosomal Subunit Protein EL42-Like; Ribosomal Protein EL42-Like; RPL36A; Ribosomal Protein HL44 |
| Gene ID | 6166 |
| UniProt ID | Q969Q0 |
| Location | Cytoplasm |
| Introduction | RPL36AL gene codes for a ribosomal protein that constitutes a part of the 60S ribosomal subunit. This protein, exhibiting sequence homology with yeast ribosomal protein L44, falls under the L44E (L36AE) family of ribosomal proteins. While this gene and the human gene officially designated as ribosomal protein L36a (RPL36A) encode proteins that are nearly indistinguishable, they represent distinct genetic entities. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
