Recombinant Protein of Human PDCD11, Partial(Cat#: RIJL-1124-JL129)
This product is a recombinant human PDCD11 protein with N-terminal 10xHis-tag and C-terminal Myc-tag. It is availible for WB, SDS-PAGE, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human PDCD11 protein with N-terminal 10xHis-tag and C-terminal Myc-tag. It is availible for WB, SDS-PAGE, positive control and immunogen. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 31.6 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | E.coli |
| Formulation | PBS with 6% trehalose |
| Residues | Partial |
| Sequence | GQALRATVVGPDSSKTLLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEER |
| Product Form | Lyophilized powder |
| Tags | N-terminal 10xHis-tag and C-terminal Myc-tag |
| Type | Recombinant Protein |
| Applications | WB; SDS-PAGE; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Programmed Cell Death 11; KIAA0185; RRP5; Programmed Cell Death Protein 11 |
| Gene ID | 22984 |
| UniProt ID | Q14690 |
| Location | Nucleus; Nucleolus |
| Introduction | PDCD11 is an NF-kappa-B (NFKB1)-binding protein that colocalizes with U3 RNA in the nucleolus and is indispensable in rRNA maturation and 18S rRNA production. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
