Recombinant Protein of Human MRPL58, aa 30-206(Cat#: RIJL-0225-JL463)
This product is a recombinant human MRPL58 protein with N-terminal His-IF2DI Tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL58 protein with N-terminal His-IF2DI Tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 36.4 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues | 30-206aa |
| Sequence | LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD |
| Product Form | Lyophilized powder |
| Tags | N-terminal His-IF2DI Tag |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L58; Large Ribosomal Subunit Protein ML62; Digestion Substraction 1; MRP-L58; Mitochondrial Large Ribosomal Subunit Protein ML62 |
| Gene ID | 3396 |
| UniProt ID | Q14197 |
| Location | Mitochondrion |
| Introduction | MRPL58 is a fundamental protein component of the mitochondrial large ribosomal subunit, playing a pivotal role in the translation of mitochondrial mRNAs into functional proteins. It is broadly distributed across multiple tissues and organs, particularly those with high energy demands such as muscle and brain. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
