Recombinant Protein of Human MRPL53, aa 1-112(Cat#: RIJL-0225-JL456)
This product is a recombinant human MRPL53 protein with N-terminal His-IF2DI Tag. It is availible for WB and ELISA.
Summary
Related Products & Services
Description
|
This product is a recombinant human MRPL53 protein with N-terminal His-IF2DI Tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity |
Human |
| Molecule Mass |
32.7 kDa |
| Purity |
>90% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues |
1-112aa |
| Sequence |
MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR |
| Product Form |
Lyophilized powder |
| Tags |
N-terminal His-IF2DI Tag |
| Type |
Recombinant Protein |
| Applications |
Western Blot; ELISA |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Mitochondrial Ribosomal Protein L53; Large Ribosomal Subunit Protein ML53; Mitochondrial Large Ribosomal Subunit Protein ML53; MRP-L53 |
| Gene ID |
116540 |
| UniProt ID |
Q96EL3 |
| Location |
Mitochondrion |
| Introduction |
MRPL53 is a crucial protein component of the mitochondrial large ribosomal subunit, tasked with facilitating the accurate translation of mitochondrial mRNAs into functional proteins. Predominantly localized within mitochondria, MRPL53 is integral to the efficient synthesis of proteins vital for cellular respiration and energy production. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.