Recombinant Protein of Human MRPL42, aa 33-142(Cat#: RIJL-0225-JL438)
This product is a recombinant human MRPL42 protein with N-terminal GST Tag. It is availible for WB, standard, immunogen, ELISA and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL42 protein with N-terminal GST Tag. It is availible for WB, standard, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 40.1 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 33-142aa |
| Sequence | KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR |
| Product Form | Lyophilized powder |
| Tags | N-terminal GST Tag |
| Type | Recombinant Protein |
| Applications | WB; Standard; Immunogen; ELISA; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L42; 39S Ribosomal Protein L42, Mitochondrial; Large Ribosomal Subunit Protein ML42; MRP-L42; Mitochondrial Large Ribosomal Subunit Protein ML42 |
| Gene ID | 28977 |
| UniProt ID | Q9Y6G3 |
| Location | Mitochondrion |
| Introduction | MRPL42, or Mitochondrial Ribosomal Protein L42, is a vital component within the mitochondrial ribosomal large subunit. Mutations or alterations in the MRPL42 gene can potentially disrupt these processes, leading to mitochondrial dysfunction and associated diseases. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
