Recombinant Protein of Human MRPL16, aa 37-251(Cat#: RIJL-0225-JL403)
This product is a recombinant human MRPL16 protein with specific tag. It is availible for WB, bioactivity testing, ELISA, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL16 protein with specific tag. It is availible for WB, bioactivity testing, ELISA, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 28.4 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 37-251aa |
| Sequence | PSFEDVSIPEKPKLRFIERAPLVPKVRREPKNLSDIRGPSTEATEFTEGNFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRMGGGKGAIDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLEKMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFYMPKRV |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Bioactivity Testing; ELISA; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L16; Large Ribosomal Subunit Protein UL16m; Mitochondrial Large Ribosomal Subunit Protein UL16m |
| Gene ID | 54948 |
| UniProt ID | Q9NX20 |
| Location | Mitochondrion |
| Introduction | MRPL16 is an indispensable part of the large ribosomal subunit in the mitochondrial translational machinery of eukaryotic organisms. It contributes significantly to the structural stability and functional integrity of the mitochondrial ribosome, which is responsible for synthesizing proteins vital for energy production and other metabolic processes. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
