Recombinant Protein of Human EXOSC6, aa 1-272(Cat#: RIJL-1124-JL162)
This product is a recombinant human EXOSC6 protein with specific tag. It is availible for ELISA, Affinity purification and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human EXOSC6 protein with specific tag. It is availible for ELISA, Affinity purification and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 28.3 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS |
| Residues | 1-272aa |
| Sequence | MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Affinity Purification; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | p11; EXOSC6; MTR3; Exosome complex component MTR3; Exosome component 6; mRNA transport regulator 3 homolog; hMtr3 |
| Gene ID | 118460 |
| UniProt ID | Q5RKV6 |
| Location | Cytoplasm; Nucleus; Nucleolus |
| Introduction | The EXOSC6 gene product forms one of the subunits of multi-subunit particles called exosomes that mediate mRNA degradation. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
