Recombinant Protein of Human AURKAIP1, aa 1-199(Cat#: RIJL-0225-JL538)
This product is a recombinant human AURKAIP1 protein with specific tag. It is availible for immunogen, SDS-PAGE, WB, bioactivity testing and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human AURKAIP1 protein with specific tag. It is availible for immunogen, SDS-PAGE, WB, bioactivity testing and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 22.4 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-199aa |
| Sequence | MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB; Bioactivity Testing; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Aurora Kinase A Interacting Protein 1; Small Ribosomal Subunit Protein MS38; AURKA-Interacting Protein; MRP-S38; Mitochondrial Small Ribosomal Subunit Protein MS38 |
| Gene ID | 54998 |
| UniProt ID | Q9NWT8 |
| Location | Mitochondrion |
| Introduction | AURKAIP1 protein serves as a critical regulator of Aurora Kinase A (AURKA), a key enzyme involved in mitotic spindle formation and chromosome segregation during cell division. AURKAIP1 interacts directly with AURKA, modulating its activity and subcellular localization. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
