Recombinant Protein of Drosophila Melanogaster RPL10, aa 1-218(Cat#: RIJL-0225-JL241)
This product is a recombinant drosophila melanogaster RPL10 protein with N-terminal 6xHis-tag. It is availible for positive control, immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant drosophila melanogaster RPL10 protein with N-terminal 6xHis-tag. It is availible for positive control, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Drosophila melanogaster |
| Molecule Mass | 29.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-218aa |
| Sequence | MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA |
| Product Form | Lyophilized powder |
| Tags | N-terminal 6xHis-tag |
| Type | Recombinant Protein |
| Applications | Positive Control; Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein UL16; 60S Ribosomal Protein L10; AUTSX5; Ribosomal Protein L10; DXS648 |
| Gene ID | 43864 |
| UniProt ID | O61231 |
| Location | Cytoplasm |
| Introduction | The RPL10 gene encodes a ribosomal protein that is an integral part of the 60S subunit, belonging to the L10E family of ribosomal proteins. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
