Recombinant Protein of Chicken RPL39L, aa 1-51(Cat#: RIJL-0225-JL313)
This product is a recombinant chicken RPL39L protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, bioactivity testing and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant chicken RPL39L protein with specific tag. It is availible for SDS-PAGE, WB, ELISA, bioactivity testing and immunogen. |
Product Property
| Species Reactivity | Chicken |
| Molecule Mass | 6.4 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-51aa |
| Sequence | MSSHKTFKIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; ELISA; Bioactivity Testing; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein L39-Like 1; Ribosomal Protein L39-Like Protein; Ribosomal Protein L39 Like; RPL39L1; Large Ribosomal Subunit Protein EL39-Like |
| Gene ID | 374132 |
| UniProt ID | Q98TF5 |
| Location | Cytoplasm |
| Introduction | RPL39L, an abbreviation standing for Ribosomal Protein L39 Like, serves as a fascinating constituent within the eukaryotic ribosomal apparatus, playing indispensable roles in both the structural integrity and functional efficiency of ribosomes. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
