Recombinant Protein of Chicken RPL15, aa 1-165(Cat#: RIJL-0225-JL260)
This product is a recombinant chicken RPL15 protein with specific tag. It is availible for bioactivity testing, ELISA, immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant chicken RPL15 protein with specific tag. It is availible for bioactivity testing, ELISA, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Chicken |
| Molecule Mass | 19.3 kDa |
| Purity | >83% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-165aa |
| Sequence | PRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKRIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQLHRYR |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Bioactivity Testing; ELISA; Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein EL15; Ribosomal Protein L15; RPLY10; 60S; 60S Ribosomal Protein L15 |
| Gene ID | 428442 |
| UniProt ID | P51417 |
| Location | Cytoplasm |
| Introduction | The RPL15 gene encodes a ribosomal protein that is a fundamental component of the 60S subunit, which constitutes the large ribosomal subunit. The ribosome, a vast ribonucleoprotein complex, is responsible for synthesizing proteins within cells. This particular protein resides in the cytoplasm. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
