Recombinant Protein of Bovine RPS2, aa 2-293(Cat#: RIJL-0225-JL323)
This product is a recombinant bovine RPS2 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine RPS2 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 31.2 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-293aa |
| Sequence | ADDAGAAGGPGGPGGPGMGGRGGFRGGFGSGVRGRGRGRGRGRGRGRGARGGKAEDKEWLPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | 40S Ribosomal Protein S2; Small Ribosomal Subunit Protein US5; 40S Ribosomal Protein S4; Ribosomal Protein S2; LLREP3 |
| Gene ID | 286867 |
| UniProt ID | O18789 |
| Location | Cytoplasm; Nucleolus; Nucleus |
| Introduction | The RPS2 protein, an abbreviation for Ribosomal Protein S2, serves as a cornerstone component within the small ribosomal subunit of eukaryotic cells. It plays a crucial role in the translation process by facilitating the precise assembly and efficient functioning of the ribosome. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
