Recombinant Protein of Bovine RPL22L1, aa 1-122(Cat#: RIJL-0225-JL273)
This product is a recombinant bovine RPL22L1 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine RPL22L1 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 14.5 kDa |
| Purity | >83% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-122aa |
| Sequence | MAPKKDKKPKKSTWKFNLDLTHAVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKNKIIVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESESED |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RPL22L160S ribosomal protein L22-like 1 |
| Gene ID | 614872 |
| UniProt ID | A4FUH0 |
| Location | Cytoplasm |
| Introduction | RPL22L1 is an constituent of the large ribosomal subunit, which is an integral part of the ribosome-a vast ribonucleoprotein complex that holds a pivotal role in synthesizing proteins within cells. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
