Recombinant Protein of Bovine MRPL28, aa 56-256(Cat#: RIJL-0225-JL422)
This product is a recombinant bovine MRPL28 protein with specific tag. It is availible for SDS-PAGE, WB, immunogen, bioactivity testing and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL28 protein with specific tag. It is availible for SDS-PAGE, WB, immunogen, bioactivity testing and ELISA. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 30.0 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 56-256aa |
| Sequence | NGQRERVEDVPIPVHYPPESQLGLWGGEGWLKGHRYVNNDKFSKRVKKVWKPQLFQRELYSEILDTRFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPDDPERRAAIYDKYKAFVIPEAEAEWVGLTLDEAVEKQRLLEEKDPVPLFKVYVEELVEQLQQQALSEPAVVQKRANRT |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; Immunogen; Bioactivity Testing; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein BL28m; MRP-L28; Mitochondrial Ribosomal Protein L28; BL28m |
| Gene ID | 508216 |
| UniProt ID | Q2HJJ1 |
| Location | Mitochondrion |
| Introduction | MRPL28 is a crucial component of the mitochondrial ribosomal large subunit in eukaryotic cells. It plays a pivotal role in the synthesis of mitochondrial proteins, which are essential for energy production, metabolic processes, and cellular signaling. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
