Recombinant Protein of Bovine MRPL28, aa 56-256(Cat#: RIJL-0225-JL422)
This product is a recombinant bovine MRPL28 protein with specific tag. It is availible for SDS-PAGE, WB, immunogen, bioactivity testing and ELISA.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine MRPL28 protein with specific tag. It is availible for SDS-PAGE, WB, immunogen, bioactivity testing and ELISA. |
Product Property
| Species Reactivity |
Bovine |
| Molecule Mass |
30.0 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
56-256aa |
| Sequence |
NGQRERVEDVPIPVHYPPESQLGLWGGEGWLKGHRYVNNDKFSKRVKKVWKPQLFQRELYSEILDTRFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPDDPERRAAIYDKYKAFVIPEAEAEWVGLTLDEAVEKQRLLEEKDPVPLFKVYVEELVEQLQQQALSEPAVVQKRANRT |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
SDS-PAGE; WB; Immunogen; Bioactivity Testing; ELISA |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Large Ribosomal Subunit Protein BL28m; MRP-L28; Mitochondrial Ribosomal Protein L28; BL28m |
| Gene ID |
508216 |
| UniProt ID |
Q2HJJ1 |
| Location |
Mitochondrion |
| Introduction |
MRPL28 is a crucial component of the mitochondrial ribosomal large subunit in eukaryotic cells. It plays a pivotal role in the synthesis of mitochondrial proteins, which are essential for energy production, metabolic processes, and cellular signaling. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.