Recombinant Protein of Bovine MRPL20, aa 46-149(Cat#: RIJL-0225-JL409)
This product is a recombinant bovine MRPL20 protein with specific tag. It is availible for WB and ELISA.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine MRPL20 protein with specific tag. It is availible for WB and ELISA. |
Product Property
Species Reactivity |
Bovine |
Molecule Mass |
17.5 kDa |
Purity |
>90% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
46-149aa |
Sequence |
VTRAFVRCTRARSLKKRHLRTLWINRITAASQEHGLKYPAFILNLIKCQVELNRKVLADLAIYEPKTFKSLAALSKRRREEGFVAALGDGKEPEGIFSRVAQHH |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Western Blot; ELISA |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Mitochondrial Large Ribosomal Subunit Protein BL20m; Mitochondrial Ribosomal Protein L20; Large Ribosomal Subunit Protein BL20m |
Gene ID |
506358 |
UniProt ID |
Q2TBR2 |
Location |
Mitochondrion |
Introduction |
MRPL20, or Mitochondrial Ribosomal Protein L20, is a key constituent of the large ribosomal subunit within the mitochondrial translational apparatus of eukaryotic cells. It serves as a structural scaffold that supports the assembly and stability of the mitochondrial ribosome, thereby facilitating the accurate and efficient synthesis of proteins essential for oxidative phosphorylation and other vital mitochondrial functions. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.