Recombinant Protein of Bovine MRPL15, aa 23-297(Cat#: RIJL-0225-JL402)
This product is a recombinant bovine MRPL15 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL15 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 33.7 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 23-297aa |
| Sequence | VSLANLRPNPGSRKPERRRRGQRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRRQYQPLSLNRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQLASELAIAAIEKNGGVVTTAFYDPRSLEILCKPIPFFLRGQPIPKRMLPPEALVPYYTDARNRGYLADPARFPEARLELAKKYGYILPDITKDELFKMLSSRKDPRQIFFGLAPGWVVNMADKKILKPTDEKLLEYYSS |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RPML7; Large Ribosomal Subunit Protein UL15m; Mitochondrial Ribosomal Protein L15; MRP-L15 |
| Gene ID | 510347 |
| UniProt ID | Q0VC21 |
| Location | Mitochondrion |
| Introduction | MRPL15 is a critical component of the large ribosomal subunit within the mitochondrial ribosome of eukaryotic cells. It plays an essential role in the structure and function of the mitochondrial ribosome, which is vital for the synthesis of proteins involved in oxidative phosphorylation and other fundamental mitochondrial activities. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
