Recombinant Protein of Bovine EXOSC8, aa 2-276(Cat#: RIJL-1124-JL169)
This product is a recombinant bovine EXOSC8 protein with specific tag. It is availible for WB, positive control and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine EXOSC8 protein with specific tag. It is availible for WB, positive control and SDS-PAGE. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 40.7 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | 2-276aa |
| Sequence | AAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNVGSIGTADGSALVKLGNTTVICGIKAEFGAPPTDAPDKGYVVPNVDLSPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISSGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEETALAEVNLKKKSCLNIRTHPVATSFAVFDDTLLIVDPTEEEEHLATGTLTVVMDEEGRLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVFKSMKPK |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Positive Control; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Exosome Component 8; PCH1C; Ribosomal RNA-Processing Protein 43 |
| Gene ID | 532080 |
| UniProt ID | Q2KHU3 |
| Location | Cytoplasm; Nucleus; Nucleolus |
| Introduction | The EXOSC8 gene encodes a 3'-5' exoribonuclease that specifically interacts with mRNAs containing AU-rich elements. The EXOSC8 protein is part of the exosome complex and is essential for the degradation of many RNA species. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
