Recombinant Protein of Mouse RPS3A, aa 2-264(Cat#: RIJL-0225-JL325)
This product is a recombinant mouse RPS3A protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPS3A protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 29.9 kDa |
| Purity | >84% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-264aa |
| Sequence | AVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGGSSGKAAGDETGAKVERADGYEPPVQESV |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | 40S Ribosomal Protein S3a; V-Fos Transformation Effector Protein 1; Ribosomal Protein S3A; Small Ribosomal Subunit Protein ES1 |
| Gene ID | 20091 |
| UniProt ID | P97351 |
| Location | Nucleus; Cytoplasm; Nucleolus |
| Introduction | The RPS3A protein, also known as Ribosomal Protein S3A, is a vital component of the small ribosomal subunit in eukaryotic cells. This protein is instrumental in maintaining the structural integrity and functional efficiency of the ribosome. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
