Recombinant Protein of Bovine RRP36, aa 1-246(Cat#: RIJL-1124-JL153)
This product is a recombinant bovine RRP36 protein with specific tag. It is availible for WB, positive control and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine RRP36 protein with specific tag. It is availible for WB, positive control and immunogen. |
Product Property
| Species Reactivity | Bovine |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | 1-246aa |
| Sequence | MRRASSCGGAVAGSPSEAQDGGEDDGSLRNDTSHMSFEELLELQSQVGTKAYKQLVTGSSTKKQSSRPPVQKGCVADKHRPLEMSAKVRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLDDIRAREKELVKKQLKKHRSGEEHEKLQHLLQRMEQQEMAQKERKRQQELRLALKQERRAQAQQGHRPYFLKKSEQRQLVLAEKFKELKRSKKLESFLSRKRRRNAGKDRRHLPLSKE |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Positive Control; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RRP36; Ribosomal RNA processing protein 36 homolog |
| Gene ID | 100125879 |
| UniProt ID | A6QNR1 |
| Location | Nucleus; Nucleolus |
| Introduction | RRP36 plays a pivotal role in the early stages of processing of 35S pre-ribosomal RNA into mature 18S species. Rrp36p protein is a nucleolar protein that interacts with 90S and pre-40S pre-ribosomal particles. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
