Recombinant Protein of Bovine RRP36, aa 1-246(Cat#: RIJL-1124-JL153)
This product is a recombinant bovine RRP36 protein with specific tag. It is availible for WB, positive control and immunogen.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine RRP36 protein with specific tag. It is availible for WB, positive control and immunogen. |
Product Property
| Species Reactivity |
Bovine |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
Low endotoxin |
| Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation |
PBS with 6% trehalose |
| Residues |
1-246aa |
| Sequence |
MRRASSCGGAVAGSPSEAQDGGEDDGSLRNDTSHMSFEELLELQSQVGTKAYKQLVTGSSTKKQSSRPPVQKGCVADKHRPLEMSAKVRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLDDIRAREKELVKKQLKKHRSGEEHEKLQHLLQRMEQQEMAQKERKRQQELRLALKQERRAQAQQGHRPYFLKKSEQRQLVLAEKFKELKRSKKLESFLSRKRRRNAGKDRRHLPLSKE |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
WB; Positive Control; Immunogen |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
RRP36; Ribosomal RNA processing protein 36 homolog |
| Gene ID |
100125879 |
| UniProt ID |
A6QNR1 |
| Location |
Nucleus; Nucleolus |
| Introduction |
RRP36 plays a pivotal role in the early stages of processing of 35S pre-ribosomal RNA into mature 18S species. Rrp36p protein is a nucleolar protein that interacts with 90S and pre-40S pre-ribosomal particles. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.